PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC012843.70
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 309aa    MW: 32703.7 Da    PI: 9.8315
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC012843.70genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.71.8e-30120173155
       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                   +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  EcC012843.70 120 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 173
                   59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.24E-20117177IPR009057Homeodomain-like
PROSITE profilePS5129410.56117176IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-30119178IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-24121173IPR006447Myb domain, plants
PfamPF002491.2E-7123172IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006511Biological Processubiquitin-dependent protein catabolic process
GO:0006904Biological Processvesicle docking involved in exocytosis
GO:0016579Biological Processprotein deubiquitination
GO:0055114Biological Processoxidation-reduction process
GO:0000145Cellular Componentexocyst
GO:0016020Cellular Componentmembrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0004843Molecular Functionthiol-dependent ubiquitin-specific protease activity
GO:0005215Molecular Functiontransporter activity
GO:0005506Molecular Functioniron ion binding
GO:0016705Molecular Functionoxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0020037Molecular Functionheme binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MREDDGGNWF TKWQVELPPP EELTPLSQSL ITPDLALAFD IGRGPSSSNN SISVVGAKQR  60
HLLPSSTPLP QQLSSSSRDS KTGAAAARQP GPVDFADSGD LGSGGGAGGG GDEPARTLKR  120
PRLVWTPQLH KRFVDAVAHL GIKNAVPKTI MQLMSVDGLT RENVASHLQK YRLYLRRMQG  180
LSGGGGGSSS ADAATERLFA SAPVPPHFLH PGRPSSDHFL ALQHHQHLAA EAAAAAAIPQ  240
YRRQVGHFGL PPNGQFEHPL LQSRQGQIAH SMGAAMSMHN PIQSSVGESD SVKGSGGRKV  300
LTLFPTGDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A9e-21119178463ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010055683.10.0PREDICTED: transcription factor PCL1-like
SwissprotQ9SNB42e-51PCL1_ARATH; Transcription factor LUX
TrEMBLA0A059DHZ70.0A0A059DHZ7_EUCGR; Uncharacterized protein
STRINGSolyc10g080960.1.11e-99(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.14e-71G2-like family protein